PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10014784
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 290aa    MW: 32095.7 Da    PI: 6.1089
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10014784genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.47e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd+llv +++++G g+W++ ++  g+ R++k+c++rw +yl
      Lus10014784 14 RGPWTSEEDDLLVTYIQKHGHGSWRSLPKLAGLLRCGKSCRLRWTNYL 61
                     89******************************99************97 PP

2Myb_DNA-binding45.51.8e-1467112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++++e+++l ++++  lG++ W++Ia+ ++ gRt++++k+ w+++l
      Lus10014784  67 RGPFSAEDEKLVIQLHGILGNR-WAAIAAQLP-GRTDNEIKNLWNTHL 112
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.6E-25564IPR009057Homeodomain-like
PROSITE profilePS5129417.273961IPR017930Myb domain
SuperFamilySSF466894.03E-3011108IPR009057Homeodomain-like
SMARTSM007179.3E-141363IPR001005SANT/Myb domain
PfamPF002493.1E-161461IPR001005SANT/Myb domain
CDDcd001671.31E-101661No hitNo description
PROSITE profilePS5129423.89162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-2465117IPR009057Homeodomain-like
SMARTSM007171.6E-1366114IPR001005SANT/Myb domain
PfamPF002492.0E-1367112IPR001005SANT/Myb domain
CDDcd001671.30E-969112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009909Biological Processregulation of flower development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MGRQPCCDKK GLKRGPWTSE EDDLLVTYIQ KHGHGSWRSL PKLAGLLRCG KSCRLRWTNY  60
LRPDIKRGPF SAEDEKLVIQ LHGILGNRWA AIAAQLPGRT DNEIKNLWNT HLKKRLVSMG  120
VDPQTHEPFD RTAAPSSPGT RHMAQWESAR LEAEARLSKA TNPATETPEA DYFLRIWNSE  180
VGESFRKLNN NGGGGGERET GTSEESTSSS TKLAANKSPK SENNANNTME LRSGDSSSCC  240
GGDMEDSSET ALQLLLDFPM EHDMSFLEDS LSDNYGTGES YESYLICHL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-281211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00114ampDAPTransfer from AT3G61250Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007051856.11e-131Myb domain protein 17 isoform 1
SwissprotQ50EX67e-67ODO1_PETHY; Protein ODORANT1
TrEMBLA0A061E1591e-131A0A061E159_THECC; Myb domain protein 17 isoform 1
STRINGPOPTR_0014s07700.11e-119(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23313280
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61250.11e-113myb domain protein 17